WP_023978793.1 has 430 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-51 158.7 7.0 9e-51 158.2 7.0 1.2 1 WP_023978793.1 Domain annotation for each sequence (and alignments): >> WP_023978793.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 158.2 7.0 9e-51 9e-51 1 181 [] 6 198 .. 6 198 .. 0.99 Alignments for each domain: == domain 1 score: 158.2 bits; conditional E-value: 9e-51 CNNM 1 liallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellae............ga 83 l+++ll++l+++f++ E+Al+s+++ rl +l++ g +ga+r+l+l ++p+ +L t++ig+tlv+il +a++++ ++e la ++ WP_023978793.1 6 LVICLLIALNSIFAMGEMALISAKRPRLAALVKRGVRGAERALRLADEPHAFLPTVQIGMTLVSILEGAFGGSQIEEDLALlirrsdmlrpfaNE 100 5789***************************************************************************99************** PP CNNM 84 lavviatvivtllilvfGEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGvkkeeepavteeelrslveeseeeGvie 178 l++ i++ ++t+++lvfGE++Pk+lal+ +ek+a +++ +l+ l ++ +P+v+ll+ +nl+lr++Gv++ ++ a+teeelr++++e+++ Gv+e WP_023978793.1 101 LSIGIVVMAITFAMLVFGELVPKQLALQQPEKMAARLSFILSALLTISRPIVALLSGTSNLVLRVFGVGGLTRAAITEEELRAILAEGAQAGVLE 195 **********************************************************************************************9 PP CNNM 179 eee 181 ee WP_023978793.1 196 TEE 198 997 PP
Or compare WP_023978793.1 to CDD or PaperBLAST