WP_027636730.1 has 427 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-66 209.6 7.9 2.2e-66 209.1 7.9 1.2 1 WP_027636730.1 Domain annotation for each sequence (and alignments): >> WP_027636730.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 209.1 7.9 2.2e-66 2.2e-66 1 180 [. 10 188 .. 10 189 .. 0.99 Alignments for each domain: == domain 1 score: 209.1 bits; conditional E-value: 2.2e-66 CNNM 1 liallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavviatvivtl 95 +i+++l++ls+ffs++EtAl+slsk+rl++++e+g +gakr++kl+e+p++lL ++lign++vni++s+lat l+++++ g+ +v iat+++t+ WP_027636730.1 10 IILIILIALSSFFSMSETALMSLSKIRLRHMVEEGVPGAKRVEKLTEDPNKLLGAILIGNNIVNIGASSLATILATNIF--GSSGVGIATGVMTI 102 6899***************************************************************************..799*********** PP CNNM 96 lilvfGEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGv.kkeeepavteeelrslveeseeeGvieee 180 l+l+fGE++Pk++a+++ae++al+va+++++ +++++P+++++++++ l++rl+G +e e+++teeel+++v +seeeGv+e+ WP_027636730.1 103 LVLIFGEVTPKSIAKQKAEAVALKVARFIEFAVVIFKPFIYIFTAISSLFIRLVGCdPNEAESFITEEELKTMVGVSEEEGVLENV 188 ***********************************************************************************975 PP
Or compare WP_027636730.1 to CDD or PaperBLAST