WP_077702194.1 has 416 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-53 166.0 5.1 5.3e-53 165.5 5.1 1.2 1 WP_077702194.1 Domain annotation for each sequence (and alignments): >> WP_077702194.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 165.5 5.1 5.3e-53 5.3e-53 1 181 [] 3 179 .. 3 179 .. 0.98 Alignments for each domain: == domain 1 score: 165.5 bits; conditional E-value: 5.3e-53 CNNM 1 liallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavviatvivtl 95 +++++ll++s ffs++EtAl++++k +l+++a + +k+a++ll+l+++pe++++++lign+++nill++l+t +++e+ + v +a +i+t+ WP_077702194.1 3 IAIIALLFVSFFFSGSETALTATNKMKLQTKASHDDKRADKLLQLVSKPEQFITSILIGNNIANILLPTLVTIVAMEYG----VNVGLASAILTI 93 57899************************************************************************98....5799******** PP CNNM 96 lilvfGEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGvkkeeepavteeelrslveeseeeGvieeee 181 i++f+E++Pk++a++ +++ia +v p++r ++++++Pl++lln+++ +i++ l ++e++ v+++e+r++v+++++eG+++++e WP_077702194.1 94 TIIIFAEVIPKSVAAAFPDRIAYIVYPVIRAVVFIFRPLTMLLNAITGFIIKYLSKGQESDASVSRDEIRAMVDIARTEGIFKQDE 179 **********************************************************************************9987 PP
Or compare WP_077702194.1 to CDD or PaperBLAST