biolip::7m1tA has 321 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-52 162.4 2.4 6.1e-52 162.0 2.4 1.2 1 biolip::7m1tA Domain annotation for each sequence (and alignments): >> biolip::7m1tA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 162.0 2.4 6.1e-52 6.1e-52 2 181 .] 9 183 .. 8 183 .. 0.98 Alignments for each domain: == domain 1 score: 162.0 bits; conditional E-value: 6.1e-52 CNNM 2 iallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavviatvivtlli 97 ++++ ll+s+ffs++E+Al+s++++++++l+ +g+kgak+l +l++ + + +t+lig t++n++ ++lata+ + l+ g+l++++ +v+ +l+ biolip::7m1tA 9 LFIAALLFSGFFSSSEVALISITRAKVHALQSQGRKGAKALDTLKRSTDAIQITTLIGSTIANVAVASLATAIGITLY--GNLGIAVGLVVAAVLV 102 6789999***********************************************************************..79************** PP CNNM 98 lvfGEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGv.kkeeepavteeelrslveeseeeGvieeee 181 lvfGEi Pk +a ++ e++al+v++p+ ++s+llyP++w+ +++ + + + + +ep+vteee+++ ++++eeeG+ieeee biolip::7m1tA 103 LVFGEIGPKMYASRYTEELALRVSRPILFFSKLLYPVLWVTDRIEQQFA----FrPGVTEPVVTEEEIKEWIDVGEEEGTIEEEE 183 ********************************************99999....8899*************************998 PP
Or compare biolip::7m1tA to CDD or PaperBLAST