VIMSS20011 has 93 amino acids
Query: RNase_P-MRP_p29 [M=84] Accession: PF01868.20 Description: Ribonuclease P/MRP, subunit p29 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-30 90.3 0.2 3.5e-30 90.1 0.2 1.0 1 VIMSS20011 Domain annotation for each sequence (and alignments): >> VIMSS20011 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.1 0.2 3.5e-30 3.5e-30 2 84 .] 6 88 .. 5 88 .. 0.98 Alignments for each domain: == domain 1 score: 90.1 bits; conditional E-value: 3.5e-30 RNase_P-MRP_p29 2 kllkadlhGaeveVvrsknpslvGikGivvdEtkntlkivtkenkvktipKegsvFefelpeeekveikGsqlllrpedRakk 84 ++++++l+G+ v+++rs ++++ Gi+G+vvdEt+ntl+i+ ++++ t+pK +vF+f+ p++e vei+G+ l++rpe+R+kk VIMSS20011 6 NIFRHELIGLSVRIARSVHRDIQGISGRVVDETRNTLRIEMDDGREITVPKGIAVFHFRTPQGELVEIDGRALVARPEERIKK 88 89*************************************************************99****************97 PP
Or compare VIMSS20011 to CDD or PaperBLAST