VIMSS9957229 has 322 amino acids
Query: RNase_P-MRP_p29 [M=84] Accession: PF01868.20 Description: Ribonuclease P/MRP, subunit p29 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-23 66.9 0.0 1.2e-22 65.9 0.0 1.5 1 VIMSS9957229 Domain annotation for each sequence (and alignments): >> VIMSS9957229 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.9 0.0 1.2e-22 1.2e-22 1 77 [. 230 305 .. 230 310 .. 0.93 Alignments for each domain: == domain 1 score: 65.9 bits; conditional E-value: 1.2e-22 RNase_P-MRP_p29 1 akllkadlhGaeveVvrsknpslvGikGivvdEtkntlkivtkenkvktipKegsvFefelpeeekveikGsqlllr 77 ++ll+adlhGa + V+++k s+ G++Gi++++t +t+ i++++n+++++pK+gsvF ++ + kv++ G++l r VIMSS9957229 230 ENLLSADLHGALLIVAECKAASYQGVNGIMIRDTAETFGIISEDNRLRVVPKAGSVFILQA-DCWKVTLIGDKLSPR 305 59***********************************************************.3338******99765 PP
Or compare VIMSS9957229 to CDD or PaperBLAST