VIMSS819168 has 75 amino acids
Query: Cas_Cas4 [M=161]
Accession: PF01930.21
Description: Domain of unknown function DUF83
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.4e-10 25.1 0.0 1e-09 24.9 0.0 1.1 1 VIMSS819168
Domain annotation for each sequence (and alignments):
>> VIMSS819168
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 24.9 0.0 1e-09 1e-09 122 160 .. 17 55 .. 14 56 .. 0.93
Alignments for each domain:
== domain 1 score: 24.9 bits; conditional E-value: 1e-09
Cas_Cas4 122 reeleeaikeieeiissekppepkkkkiCkkCayaelCl 160
r ++ +i ++e+++s ++p+p + k Ck+C++ e+C
VIMSS819168 17 RAQTLATIAAVRELLNSGQTPPPDYGKRCKACSLVEICQ 55
6778899*******************************7 PP
Or compare VIMSS819168 to CDD or PaperBLAST