VIMSS819168 has 75 amino acids
Query: Cas_Cas4 [M=162]
Accession: PF01930.20
Description: Domain of unknown function DUF83
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.1e-10 27.1 0.0 2.7e-10 26.8 0.0 1.1 1 VIMSS819168
Domain annotation for each sequence (and alignments):
>> VIMSS819168
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 26.8 0.0 2.7e-10 2.7e-10 123 161 .. 17 55 .. 14 56 .. 0.94
Alignments for each domain:
== domain 1 score: 26.8 bits; conditional E-value: 2.7e-10
Cas_Cas4 123 reelekaikeieeiissekppevkkkkiCkkCayaelCl 161
r ++ +i+ ++e+++s ++p++ + k Ck+C++ e+C
VIMSS819168 17 RAQTLATIAAVRELLNSGQTPPPDYGKRCKACSLVEICQ 55
778999********************************7 PP
Or compare VIMSS819168 to CDD or PaperBLAST