PaperBLAST – Find papers about a protein or its homologs

 

Align WP_001341279.1 to PF01931 (NTPase_I-T)

WP_001341279.1 has 173 amino acids

Query:       NTPase_I-T  [M=163]
Accession:   PF01931.18
Description: Protein of unknown function DUF84
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      1e-56  177.4   0.0    1.2e-56  177.2   0.0    1.0  1  WP_001341279.1  


Domain annotation for each sequence (and alignments):
>> WP_001341279.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  177.2   0.0   1.2e-56   1.2e-56       1     162 [.       7     165 ..       7     166 .. 0.97

  Alignments for each domain:
  == domain 1  score: 177.2 bits;  conditional E-value: 1.2e-56
                     S---HHHHHHHHHHHHHHCTT..EEEEEEE---SS-SS-BSHHHHHHHHHHHHHHHHHHSTTSSEEEEEEEEEET....TEEEEEE.EEEESS-E CS
      NTPase_I-T   1 gSkNpvKveAvkeafeklfkd..vevegvsvpsgvsdqPmgdeetlkGAinRaknaleaaeeadygvGlEgGveeleeklldvawaavvdkegrv 93 
                     +++Np+K++A+ +af+++f +  +++ +v+v+sgv++qP+g+eet++GA+nR++na++  +ead++v++E+G++       +++w+++ ++ +++
  WP_001341279.1   7 ATTNPAKIQAILQAFHEIFGEgsCHIASVAVESGVPEQPFGSEETRAGARNRVANARRLLPEADFWVAIEAGIDG----DSTFSWVVIENA-SQR 96 
                     69******************9899999**********************************************66....789****88888.799 PP

                     EEEE---EE--HHHHHHHCTT--HHHHHHHHHTHCCHHHTTHHHHHHTTTSS-HHHHHHHHHHHHTHHH CS
      NTPase_I-T  94 svgrsasfelPeevveevkegeelgevmdelfgtenikqkeGaigllTkglvtRedlyeqavilAlipf 162
                     + +rsa+++lP  ++e+v+ege lg+vm++++g ++i++keGaig++T g++tR+++y+qavilAl pf
  WP_001341279.1  97 GEARSATLPLPAVILEKVREGEALGPVMSRYTGIDEIGRKEGAIGVFTAGKLTRASVYHQAVILALSPF 165
                     ********************************************************************9 PP



Or compare WP_001341279.1 to CDD or PaperBLAST