PaperBLAST – Find papers about a protein or its homologs

 

Align WP_017377737.1 to PF01931 (NTPase_I-T)

WP_017377737.1 has 181 amino acids

Query:       NTPase_I-T  [M=163]
Accession:   PF01931.18
Description: Protein of unknown function DUF84
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.7e-57  179.3   0.0    3.1e-57  179.1   0.0    1.0  1  WP_017377737.1  


Domain annotation for each sequence (and alignments):
>> WP_017377737.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  179.1   0.0   3.1e-57   3.1e-57       1     163 []      11     174 ..      11     174 .. 0.96

  Alignments for each domain:
  == domain 1  score: 179.1 bits;  conditional E-value: 3.1e-57
                     S---HHHHHHHHHHHHHHCTTEE..EEEEE---SS-SS-BSHHHHHHHHHHHHHHHHHHSTTSSEEEEEEEEEET....TEEEEEE.EEEESS-E CS
      NTPase_I-T   1 gSkNpvKveAvkeafeklfkdve..vegvsvpsgvsdqPmgdeetlkGAinRaknaleaaeeadygvGlEgGveeleeklldvawaavvdkegrv 93 
                     gS+NpvKv+A+++++++++++++  ++gv++ps+v+dqPm++++t+ GA+nR++ ++e+a ++d++ ++EgGv+ +e + +++a++++ ++ g+ 
  WP_017377737.1  11 GSQNPVKVSAARAVIARYYPKARifCQGVAAPSQVADQPMSEQDTRIGALNRVAFCKEYAGDVDFYMAMEGGVDCFEYDAATFAYVVIDHQ-GHQ 104
                     8*******************9554388***********************************************************66655.9** PP

                     EEEE---EE--HHHHHHHCTT--HHHHHHHHHTHCCHHHTTHHHHHHTTTSS-HHHHHHHHHHHHTHHHH CS
      NTPase_I-T  94 svgrsasfelPeevveevkegeelgevmdelfgtenikqkeGaigllTkglvtRedlyeqavilAlipfl 163
                     s+grsa+++lP+ v++++++geelg+vmd+lf+t+nik+k+Gai+llT+g+v+R++ y +a++lA++pfl
  WP_017377737.1 105 SIGRSANLPLPKVVCQALLDGEELGQVMDRLFHTQNIKHKGGAIALLTNGHVSRKSCYIEALTLAMTPFL 174
                     ********************************************************************96 PP



Or compare WP_017377737.1 to CDD or PaperBLAST