PaperBLAST – Find papers about a protein or its homologs

 

Align WP_080099438.1 to PF01931 (NTPase_I-T)

WP_080099438.1 has 183 amino acids

Query:       NTPase_I-T  [M=163]
Accession:   PF01931.18
Description: Protein of unknown function DUF84
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.4e-63  198.9   0.0    2.8e-63  198.7   0.0    1.0  1  WP_080099438.1  


Domain annotation for each sequence (and alignments):
>> WP_080099438.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  198.7   0.0   2.8e-63   2.8e-63       1     163 []      16     175 ..      16     175 .. 0.96

  Alignments for each domain:
  == domain 1  score: 198.7 bits;  conditional E-value: 2.8e-63
                     S---HHHHHHHHHHHHHHCTT..EEEEEEE---SS-SS-BSHHHHHHHHHHHHHHHHHHSTTSSEEEEEEEEEET....TEEEEEE.EEEESS-E CS
      NTPase_I-T   1 gSkNpvKveAvkeafeklfkd..vevegvsvpsgvsdqPmgdeetlkGAinRaknaleaaeeadygvGlEgGveeleeklldvawaavvdkegrv 93 
                     +S+Np+Kv+Av++af+++f+d  +e+ gvsv+s+v+dqPm+deet +GA+nR++na+++++ a+y+vGlE+G+ee      ++aw++v +  +++
  WP_080099438.1  16 ASQNPAKVNAVRSAFSTVFPDqeWEFIGVSVQSEVADQPMSDEETKQGALNRVRNAKQHHPGAEYYVGLEAGIEE----NKTFAWMIVESD-QQR 105
                     79******************98899************************************************98....679****66655.899 PP

                     EEEE---EE--HHHHHHHCTT--HHHHHHHHHTHCCHHHTTHHHHHHTTTSS-HHHHHHHHHHHHTHHHH CS
      NTPase_I-T  94 svgrsasfelPeevveevkegeelgevmdelfgtenikqkeGaigllTkglvtRedlyeqavilAlipfl 163
                     + +rsa ++lP+ v+e++++ +elg+vmde+fgtenikqk+GaigllT++++tR+++y+qa+ilAlipf+
  WP_080099438.1 106 GESRSACLMLPPLVLERLRQAKELGDVMDEVFGTENIKQKGGAIGLLTRHHLTRSTVYHQALILALIPFI 175
                     ********************************************************************96 PP



Or compare WP_080099438.1 to CDD or PaperBLAST