CAZy::BAA02380.1 has 725 amino acids
Query: DUF92 [M=251]
Accession: PF01940.20
Description: Integral membrane protein DUF92
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7e-14 37.8 0.0 1.2e-13 37.0 0.0 1.4 1 CAZy::BAA02380.1
Domain annotation for each sequence (and alignments):
>> CAZy::BAA02380.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 37.0 0.0 1.2e-13 1.2e-13 122 157 .. 1 36 [. 1 37 [. 0.96
Alignments for each domain:
== domain 1 score: 37.0 bits; conditional E-value: 1.2e-13
DUF92 122 laDTlaSElGkllskkprlittlkkvppGtnGgVsl 157
+aDT+aSE+Gkl+++kp+ + + kkv++G++Gg++
CAZy::BAA02380.1 1 MADTWASEIGKLSQDKPFDLFSGKKVEKGVSGGITS 36
69***********99*******************95 PP
Or compare CAZy::BAA02380.1 to CDD or PaperBLAST