VIMSS1099789 has 156 amino acids
Query: Ni_insertion [M=375] Accession: PF01969.21 Description: Nickel insertion protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-51 161.5 0.1 2.1e-51 161.2 0.1 1.0 1 VIMSS1099789 Domain annotation for each sequence (and alignments): >> VIMSS1099789 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 161.2 0.1 2.1e-51 2.1e-51 238 375 .] 11 148 .. 4 148 .. 0.97 Alignments for each domain: == domain 1 score: 161.2 bits; conditional E-value: 2.1e-51 Ni_insertion 238 eeleeeevvvletniDDmtpevlgyvieklleaGAlDvfltpilmKKnRpgvlltvlckeekaeklaeilfretttlGvReseveRlvleReieeve 334 e+++++++vle+niDD ++e l+ v++ l+++GAlD+f+ pi+mKKnRp+++ltv+++++++++++ +++++t+t+GvR++++ R++++R++ +v+ VIMSS1099789 11 VEEKADQILVLEANIDDQSAESLAPVLDLLMDNGALDAFFSPIQMKKNRPAIKLTVMIHPADQQAITYLILKHTSTVGVRYQTMGRTIMPRHFMTVT 107 46889******************************************************************************************** PP Ni_insertion 335 telgevrvKvakekeivkvkpEyedlkkiAeetglplkevy 375 t++g++rvKv+++++i k++pE++d+ ++A++ +++l++vy VIMSS1099789 108 TSYGDIRVKVVNYDDIEKYTPEFDDCLAAAKAYDVALNQVY 148 ***********999*************************97 PP
Or compare VIMSS1099789 to CDD or PaperBLAST