biolip::5trdA has 219 amino acids
Query: CTP-dep_RFKase [M=121] Accession: PF01982.20 Description: Domain of unknown function DUF120 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-48 149.5 0.1 3.3e-48 149.0 0.1 1.3 1 biolip::5trdA Domain annotation for each sequence (and alignments): >> biolip::5trdA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 149.0 0.1 3.3e-48 3.3e-48 1 121 [] 95 214 .. 95 214 .. 0.99 Alignments for each domain: == domain 1 score: 149.0 bits; conditional E-value: 3.3e-48 CTP-dep_RFKase 1 VvsGlgeGkyyvslegykeqfeeklgfePypGTLNvkldeeslelrkaleklkgieiegfeeeertfgevkaypakiegieaavvvperthyped 95 V+sG+geG+yyv +++y qf+eklg+ Py GTLN+k+d++sl + ++++ ++gi+iegf++e+rtfg+vka+paki++i++ v++pert y +d biolip::5trdA 95 VTSGMGEGRYYVARKQYIIQFQEKLGIIPYLGTLNIKVDQASLPELRKIRGFRGIHIEGFKTEDRTFGSVKAFPAKIQNIPCFVIMPERTVY-TD 188 89******************************************************************************************.9* PP CTP-dep_RFKase 96 vlEiiapvkLReklelkdgdeveiev 121 v+Eii++++LRe+++l+dgd+v++ev biolip::5trdA 189 VIEIISDKYLREEINLHDGDRVSVEV 214 ************************97 PP
Or compare biolip::5trdA to CDD or PaperBLAST