VIMSS157689 has 161 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-51 157.7 0.3 7.9e-51 157.5 0.3 1.0 1 VIMSS157689 Domain annotation for each sequence (and alignments): >> VIMSS157689 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 157.5 0.3 7.9e-51 7.9e-51 6 128 .. 18 156 .. 13 157 .. 0.97 Alignments for each domain: == domain 1 score: 157.5 bits; conditional E-value: 7.9e-51 YbeY 6 eleklikkvleaalkeeklkkeaelsvllvdneeikelnkeyrnkdkpTDVLSFpleeeeee................lGDivisvekaeeqaeeygh 87 e ++l++++l+ a++++k+++ +els+++++ne i+e+n+eyr+kd++TDV+SF+lee + lGDi+is+ekaeeqa++ygh VIMSS157689 18 EDKQLVENILQFAAEYLKIEQGTELSLTFTTNEGIREINREYRDKDQATDVISFALEEMGDGeteidwgefdletprmLGDIIISTEKAEEQAKDYGH 115 66899******************************************************9999*********************************** PP YbeY 88 slerelafllvHglLHLlGYDHeeeeeekeMeekeeeilkk 128 + +rel+fl+vHglLHLlGYDH+e++eek+M+ +++e+l++ VIMSS157689 116 TKARELGFLAVHGLLHLLGYDHMEPDEEKVMFGLQKEVLDA 156 **************************************986 PP
Or compare VIMSS157689 to CDD or PaperBLAST