VIMSS39068 has 157 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-54 167.5 0.7 7.2e-54 167.4 0.7 1.0 1 VIMSS39068 Domain annotation for each sequence (and alignments): >> VIMSS39068 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 167.4 0.7 7.2e-54 7.2e-54 4 128 .. 15 151 .. 12 152 .. 0.97 Alignments for each domain: == domain 1 score: 167.4 bits; conditional E-value: 7.2e-54 YbeY 4 eeeleklikkvleaalkeeklkkeaelsvllvdneeikelnkeyrnkdkpTDVLSFpleeeeee............lGDivisvekaeeqaeeyghsle 90 +ee+ k ++++l+ a+++e ++++ae+sv++v+n+ i+++nkeyr+kd+pTDV+SF+leee e lGDi+is+++ +eqaeey+hs++ VIMSS39068 15 SEEMLKEVENLLQFAAEREGVQDQAEVSVTIVSNDDIHQINKEYRGKDAPTDVISFALEEEGEGeieivgaemppvLGDIIISADRTREQAEEYNHSFK 113 6778899999****************************************************99*********************************** PP YbeY 91 relafllvHglLHLlGYDHeeeeeekeMeekeeeilkk 128 rel+fl+vHg+LHLlGYDH+++eee+eM++k++e+l++ VIMSS39068 114 RELGFLAVHGFLHLLGYDHMTKEEEEEMFTKQKELLDA 151 ***********************************986 PP
Or compare VIMSS39068 to CDD or PaperBLAST