VIMSS956846 has 176 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-42 129.6 0.2 4.1e-42 129.4 0.2 1.1 1 VIMSS956846 Domain annotation for each sequence (and alignments): >> VIMSS956846 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 129.4 0.2 4.1e-42 4.1e-42 5 129 .] 16 158 .. 13 158 .. 0.92 Alignments for each domain: == domain 1 score: 129.4 bits; conditional E-value: 4.1e-42 YbeY 5 eeleklikkvleaal......keeklkkeaelsvllvdneeikelnkeyrnkdkpTDVLSFpleeeeee............lGDivisvekaeeqaee 84 +++e+l+++++++a+ + ++e+e+sv++ dn+++++lnk++r+kd+pT+VLSFp+ e+ee lGDi++++++a+++a e VIMSS956846 16 SNWEALAQTACQQAVsvsasdFLLAKDYETEISVCFSDNDTVHALNKTWRDKDRPTNVLSFPMMEAEELaeiknrvgseclLGDIILAFDVAKKEALE 113 677788888888888777764234568999************************************9999**************************** PP YbeY 85 yghslerelafllvHglLHLlGYDHeeeeeekeMeekeeeilkkl 129 g sle+++++l++Hg+LHLlGYDH+ ++e+++Me++e++ l++l VIMSS956846 114 KGISLENHVTHLITHGTLHLLGYDHILDNEAEIMEDLERKALAQL 158 ****************************************99875 PP
Or compare VIMSS956846 to CDD or PaperBLAST