WP_010970840.1 has 168 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-44 134.6 0.0 1.2e-43 134.3 0.0 1.1 1 WP_010970840.1 Domain annotation for each sequence (and alignments): >> WP_010970840.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 134.3 0.0 1.2e-43 1.2e-43 5 127 .. 19 154 .. 16 156 .. 0.88 Alignments for each domain: == domain 1 score: 134.3 bits; conditional E-value: 1.2e-43 YbeY 5 eeleklikkvleaal......keekl.kkeaelsvllvdneeikelnkeyrnkdkpTDVLSFpleeeeee......lGDivisvekaeeqaeeyg 86 e+l++ ++kvl+aa+ +e+ + k +els++++d+e+i+e+n+e+r+kdk+T+VLSFp+ e lGDivi+ e++e++a e + WP_010970840.1 19 ENLAAFATKVLNAAVdflkreEEQPFpKMPVELSLVFTDDENIREINAEWRDKDKATNVLSFPAFPLEPGgmpgpmLGDIVIARETVEREALELD 113 5566667777777776665542222325569*********************************99999999*********************** PP YbeY 87 hslerelafllvHglLHLlGYDHeeeeeekeMeekeeeilk 127 +s+e++l++llvHg+LHL+GYDH++eee++eMe++e++il+ WP_010970840.1 114 KSFEDHLTHLLVHGFLHLFGYDHMDEEEAEEMESLETRILA 154 ***************************************97 PP
Or compare WP_010970840.1 to CDD or PaperBLAST