WP_014262693.1 has 162 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-48 150.5 3.4 1.4e-48 150.3 3.4 1.0 1 WP_014262693.1 Domain annotation for each sequence (and alignments): >> WP_014262693.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 150.3 3.4 1.4e-48 1.4e-48 7 128 .. 19 155 .. 12 156 .. 0.96 Alignments for each domain: == domain 1 score: 150.3 bits; conditional E-value: 1.4e-48 YbeY 7 leklikkvleaalkeeklkkeaelsvllvdneeikelnkeyrnkdkpTDVLSFpleeeeee...............lGDivisvekaeeqaeeyg 86 +k++++++e a+++e+l+ ++e+s+ +v+ ++i+eln+++r++d++TDVLSFp+ e ee +GDiv+++++a eqa+eyg WP_014262693.1 19 FQKTLSDIIEYAMETEHLTGDYEVSLSVVSADQIRELNANFRQIDRITDVLSFPMYEREELdeieekkeyedyevnIGDIVLCYDRAVEQAKEYG 113 67889999*************************************************999999******************************** PP YbeY 87 hslerelafllvHglLHLlGYDHeeeeeekeMeekeeeilkk 128 hsl+re+++l++H+++HLlGYDH+eeee++ M+++ee++l++ WP_014262693.1 114 HSLKREICYLVTHSIFHLLGYDHMEEEEKQMMRTREEQVLSH 155 ***************************************986 PP
Or compare WP_014262693.1 to CDD or PaperBLAST