SwissProt::F2RB78 has 328 amino acids
Query: PDH_N [M=154] Accession: PF02153.21 Description: Prephenate dehydrogenase, nucleotide-binding domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-10 27.1 0.0 2.1e-10 26.5 0.0 1.3 1 SwissProt::F2RB78 Domain annotation for each sequence (and alignments): >> SwissProt::F2RB78 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.5 0.0 2.1e-10 2.1e-10 40 111 .. 59 129 .. 20 136 .. 0.83 Alignments for each domain: == domain 1 score: 26.5 bits; conditional E-value: 2.1e-10 PDH_N 40 ieavkeadivllavPvevilevlkelaphlkedalitDvgsvKekvvkelekllkgksfvgghPmaGteksG 111 +a+++ad+vllav +v l+ ++ ++ ++++al+ D+ sv++ ++ el ++ +g++ vg Pm+ + + G SwissProt::F2RB78 59 AAALRDADLVLLAVHEDVALKAVAPVTRLMRPGALLADTLSVRTGMAAELAAHAPGVQHVGLNPMFAP-AAG 129 6789**************************************************************98.555 PP
Or compare SwissProt::F2RB78 to CDD or PaperBLAST