VIMSS22097 has 620 amino acids
Query: PDH_N [M=154] Accession: PF02153.21 Description: Prephenate dehydrogenase, nucleotide-binding domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-14 39.5 0.0 3.9e-14 38.6 0.0 1.4 1 VIMSS22097 Domain annotation for each sequence (and alignments): >> VIMSS22097 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.6 0.0 3.9e-14 3.9e-14 34 108 .. 35 107 .. 29 138 .. 0.90 Alignments for each domain: == domain 1 score: 38.6 bits; conditional E-value: 3.9e-14 PDH_N 34 deatddieavkeadivllavPvevilevlkelaphlkedalitDvgsvKekvvkelekllkgksfvgghPmaGte 108 d+ + d + ++ +d++++++P+ +++e l+ ++ k++al++Dv+svK+ v e++ f + hPm G++ VIMSS22097 35 DQMKRDTNSISGFDVIFVCTPMYALEEALEHIKREAKKEALLVDVSSVKKVSVPLFEESGF--DFLSIHPMLGGD 107 677778899*****************************************99999999988..**********94 PP
Or compare VIMSS22097 to CDD or PaperBLAST