VIMSS544202 has 591 amino acids
Query: PDH_N [M=154] Accession: PF02153.21 Description: Prephenate dehydrogenase, nucleotide-binding domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-09 24.1 0.0 1.1e-08 20.9 0.0 2.6 3 VIMSS544202 Domain annotation for each sequence (and alignments): >> VIMSS544202 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.9 0.0 1.1e-08 1.1e-08 42 108 .. 41 104 .. 17 124 .. 0.87 2 ? -3.5 0.0 0.36 0.36 117 135 .. 178 196 .. 176 213 .. 0.62 3 ? -1.9 0.0 0.11 0.11 27 59 .. 346 380 .. 337 394 .. 0.81 Alignments for each domain: == domain 1 score: 20.9 bits; conditional E-value: 1.1e-08 PDH_N 42 avkeadivllavPvevilevlkelaphlkedalitDvgsvKekvvkelekllkgksfvgghPmaGte 108 + ++++ ++la+P + e+l +l++ + + +i+D++s K v+ +e+ +f + hP++G+ VIMSS544202 41 EFSKFKYAILAIPENSYNEILSKLKE-NNFNGVIIDLASKKDVVIPIIEQYGF--KFLSLHPLFGPS 104 4578899******************9.788999*****************999..**********94 PP == domain 2 score: -3.5 bits; conditional E-value: 0.36 PDH_N 117 eelfenavviLtPtektdk 135 e l+e+++ iL + +k+ + VIMSS544202 178 ERLLEQNPQILLDIQKEKN 196 5677777777777776332 PP == domain 3 score: -1.9 bits; conditional E-value: 0.11 PDH_N 27 alelglvdeatdd..ieavkeadivllavPvevil 59 + +l++++ ++ + ++a+++ +i+l vP+e +l VIMSS544202 346 KTRLNIKYYRKIShiFDALENNEIALGIVPIENVL 380 55899999988887789999999999999999875 PP
Or compare VIMSS544202 to CDD or PaperBLAST