VIMSS551059 has 295 amino acids
Query: PDH_N [M=154]
Accession: PF02153.21
Description: Prephenate dehydrogenase, nucleotide-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-06 14.0 0.0 2.5e-06 13.3 0.0 1.3 1 VIMSS551059
Domain annotation for each sequence (and alignments):
>> VIMSS551059
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 13.3 0.0 2.5e-06 2.5e-06 42 107 .. 64 129 .. 25 141 .. 0.85
Alignments for each domain:
== domain 1 score: 13.3 bits; conditional E-value: 2.5e-06
PDH_N 42 avkeadivllavPvevilevlkelaphlkedalitDvgsvKekvvkelekllkgksfvgghPmaGt 107
++ a+ v+ a P v ++ l + +++ d+ i+ + sv + +l++ +g+ f+g Pm+ +
VIMSS551059 64 VLSGAKAVVFALPEAVAIQALPWVLSAIGDDVQIVSTCSVQAPFYSALRAAAPGQPFIGVNPMFSP 129
345679*********************************************************976 PP
Or compare VIMSS551059 to CDD or PaperBLAST