WP_012723043.1 has 290 amino acids
Query: PDH_N [M=154]
Accession: PF02153.21
Description: Prephenate dehydrogenase, nucleotide-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.2e-09 21.3 0.0 1.2e-08 20.7 0.0 1.3 1 WP_012723043.1
Domain annotation for each sequence (and alignments):
>> WP_012723043.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 20.7 0.0 1.2e-08 1.2e-08 2 108 .. 20 125 .. 19 144 .. 0.93
Alignments for each domain:
== domain 1 score: 20.7 bits; conditional E-value: 1.2e-08
PDH_N 2 aralrrkgfkvtvigydideekakaalelglvdeatddieavkeadivllavPvevilevlkelaphlkedalitDvgsvKekvvkelekllkgk 96
r l+++g +v+v+ + e++++ e+++ +d + ++a v+ a P v + ++ l+ +++++ + sv k+l++ +++
WP_012723043.1 20 SRILKQYGYFVRVVDRRPAEFECEYH-EMDVTKPFNDTGAVFRNATAVVFALPESVAVSAIPWVTTFLSSEVVLIPTCSVQGPFYKALKAAAPRQ 113
689********************999.999999999987889***************************************************** PP
PDH_N 97 sfvgghPmaGte 108
fvg Pm+ ++
WP_012723043.1 114 PFVGVNPMFSPK 125
********9884 PP
Or compare WP_012723043.1 to CDD or PaperBLAST