biolip::2pv7B has 280 amino acids
Query: PDH_N [M=154]
Accession: PF02153.21
Description: Prephenate dehydrogenase, nucleotide-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.6e-18 50.7 0.0 1.2e-17 50.0 0.0 1.4 1 biolip::2pv7B
Domain annotation for each sequence (and alignments):
>> biolip::2pv7B
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 50.0 0.0 1.2e-17 1.2e-17 42 108 .. 50 115 .. 25 149 .. 0.88
Alignments for each domain:
== domain 1 score: 50.0 bits; conditional E-value: 1.2e-17
PDH_N 42 avkeadivllavPvevilevlkelaphlkedalitDvgsvKekvvkelekllkgksfvgghPmaGte 108
+ +ad+v+++vP++ +le+++ l+p l e++l+ D++svK ++ ++ ++ + g hPm+G +
biolip::2pv7B 50 ILANADVVIVSVPINLTLETIERLKPYLTENMLLADLTSVKREPLAKMLEVHT-GAVLGLHPMFGAD 115
56799**************************************9999988888.799********94 PP
Or compare biolip::2pv7B to CDD or PaperBLAST