VIMSS6629109 has 438 amino acids
Query: DUF155 [M=174] Accession: PF02582.17 Description: RMND1/Sif2-Sif3/Mrx10, DUF155 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-60 189.8 1.1 4.1e-60 189.0 1.1 1.4 1 VIMSS6629109 Domain annotation for each sequence (and alignments): >> VIMSS6629109 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 189.0 1.1 4.1e-60 4.1e-60 1 174 [] 215 387 .. 215 387 .. 0.96 Alignments for each domain: == domain 1 score: 189.0 bits; conditional E-value: 4.1e-60 DUF155 1 vfifenGsvVfwgldeeeekrflnkllrfaeseslpeeeeqeteelefvydeseksriqgdvivl.gsksllaklafShaLaqSvkLavlEssldel 96 +fife+G+vV+wg + +ee++fl++l +f++++ l++e++q ee+++ +++s+++ri++d+i+l ++++++ kl++ShaLaqSvk++++E+ +d++ VIMSS6629109 215 IFIFEYGVVVMWGYSTKEEAAFLEDLAKFESEK-LSSEDIQ-IEEFNYYITKSYQPRIYNDFITLrDDNNYMLKLSISHALAQSVKISLFEELVDNT 309 7****************************7776.5555555.89*********************77779*************************** PP DUF155 97 lestekipkeLakkgklklsrkeilkktgellslranlnlkselldtPdffWeepeleklyeeiseyleikeRikiLn 174 +e t+ ip+++a++gk+ ++r+ei+k++gel+ lr+n+nl+ ++ld+P+++W ep+le++y++++ ylei++R+++Ln VIMSS6629109 310 IEDTQDIPQQIAHTGKVAMTRDEIMKSIGELFILRININLHGSVLDSPELMWAEPHLEPIYQATRGYLEINQRVELLN 387 *****************************************************************************9 PP
Or compare VIMSS6629109 to CDD or PaperBLAST