PaperBLAST – Find papers about a protein or its homologs

 

Align ecocyc::G7529-MONOMER to PF02594 (DUF167)

ecocyc::G7529-MONOMER has 96 amino acids

Query:       DUF167  [M=76]
Accession:   PF02594.20
Description: Uncharacterised ACR, YggU family COG1872
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    1.4e-29   88.4   0.2    1.6e-29   88.2   0.2    1.1  1  ecocyc::G7529-MONOMER  


Domain annotation for each sequence (and alignments):
>> ecocyc::G7529-MONOMER  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   88.2   0.2   1.6e-29   1.6e-29       1      75 [.      10      81 ..      10      82 .. 0.95

  Alignments for each domain:
  == domain 1  score: 88.2 bits;  conditional E-value: 1.6e-29
                 DUF167  1 gvllavrvkPgakkdaigeeeaegrealkvrvaappvdGkANaaliefLakalgvpksdveivsGetsreKvvri 75
                           g++l+++++P+a++d+i+     +++++kv+++appvdG+AN +l++fL k+++v+ks+v i++Ge +r+K+++i
  ecocyc::G7529-MONOMER 10 GLVLRLYIQPKASRDSIV---GLHGDEVKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVVIEKGELGRHKQIKI 81
                           589***************...456677**********************************************98 PP



Or compare ecocyc::G7529-MONOMER to CDD or PaperBLAST