PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS166582 to PF03235 (DUF262)

VIMSS166582 has 393 amino acids

Query:       DUF262  [M=221]
Accession:   PF03235.14
Description: Protein of unknown function DUF262
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      2e-32   99.2   5.9      2e-32   99.2   5.9    2.4  2  VIMSS166582  


Domain annotation for each sequence (and alignments):
>> VIMSS166582  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   99.2   5.9     2e-32     2e-32       8     220 ..      47     223 ..      11     224 .. 0.78
   2 ?    0.5   1.8     0.033     0.033     144     185 ..     289     330 ..     254     391 .. 0.48

  Alignments for each domain:
  == domain 1  score: 99.2 bits;  conditional E-value: 2e-32
       DUF262   8 skrg.lriPdfQRpyvWeeeqveeLiedllalkgyplGsivlwskaadsageleviDGQQRltTltlllaatkeesekriknleaeiekekeeededr 104
                   ++g  +iP fQR+yvW+ +++++Lie++   +g p++ i+l    +++ ++++viDGQQRl +++ +++        r+   e+ +e  +  e+  +
  VIMSS166582  47 MESGaVKIPGFQRNYVWDLNRASKLIESI--ILGLPIPQIFL---YEEDRNKFLVIDGQQRLMSIYYFMKR-------RFPVKEKRVELRLIFEKFGK 132
                  4444579**********************..***********...8889**********************.......33333333333333333334 PP

       DUF262 105 lkrreresdkellqkllrseklslee.keelaelnsltkkdlakeekrneeknlikayevieeilksallsalktklslieieleseddedqayeiFe 201
                  +  ++ ++++ +++  l+  +    +  ++ +++++l++++l ++ k+++e + i++  v ++++k                     dd++ +yeiF+
  VIMSS166582 133 IPDDILHDNNYFIDFDLSLPQ----KlPKQPNKFKGLNYYTL-DDYKTQFELRPIRNVIVKQNFPK---------------------DDDSSIYEIFN 204
                  444444555555544444444....44445566677777777.55678888889999999988544.....................78899****** PP

       DUF262 202 rlNsrGvpLtasellkall 220
                  rlNs+Gv L ++e++ +l+
  VIMSS166582 205 RLNSGGVNLYPQEIRASLY 223
                  ***************9987 PP

  == domain 2  score: 0.5 bits;  conditional E-value: 0.033
       DUF262 144 dlakeekrneeknlikayevieeilksallsalktklsliei 185
                  + ++e++ ++e+ +++ +++ e+ +++ +++++ +++ ++ +
  VIMSS166582 289 NNSHEQNQYLENLFKSFLKQCESLPQEPFMKKRNNRFHIALF 330
                  112333333333333333333332222233333222222222 PP



Or compare VIMSS166582 to CDD or PaperBLAST