PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1878 to PF03235 (DUF262)

VIMSS1878 has 584 amino acids

Query:       DUF262  [M=221]
Accession:   PF03235.14
Description: Protein of unknown function DUF262
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------  -----------
    2.8e-37  115.2   0.1    6.7e-37  113.9   0.0    1.7  2  VIMSS1878  


Domain annotation for each sequence (and alignments):
>> VIMSS1878  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  113.9   0.0   6.7e-37   6.7e-37       2     217 ..      14     226 ..      13     230 .. 0.74
   2 ?   -2.7   0.0       0.3       0.3     122     165 ..     297     340 ..     285     365 .. 0.57

  Alignments for each domain:
  == domain 1  score: 113.9 bits;  conditional E-value: 6.7e-37
     DUF262   2 edllskskrg.lriPdfQRpyvWeeeqveeLiedllalkgyplGsivlw............skaadsageleviDGQQRltTltlllaatkeesekrikn 88 
                + ll+++++g + +Pd+QRp+vW++ +v++L++++  ++gyp+G++++w               +++ ++l+v+DGQQRlt+l+ ++++     +k++ +
  VIMSS1878  14 GGLLENIDSGeIGLPDIQRPFVWDTTRVRDLFDSM--YRGYPIGTLLFWengfpgehrtigTGPKKKVPRLLVVDGQQRLTALYSVMKG-VPIVDKNFRQ 110
                5789999999999**********************..********************9997555566**********************.3333344443 PP

     DUF262  89 leaeiek....ekeeededrlkrreresdkellqkllrseklsleekeelaelnsltkkdlakeekrneeknlikayevieeilksallsalktklslie 184
                    i      ek+e  +   ++ er+  +    ++l +e+++l + ++++ ++  +++ l++ee+ +  ++++k+ ++ +              + ++ 
  VIMSS1878 111 RRLRIAFnpleEKFEVTN---TSIERDPTWISDISILWQEGFALYDFISSFMKRLEERRGLTEEERQRIPRSIQKLVNLVN--------------YPMTA 193
                333333332212222222...334555677777778888888877766665555666666655554444444444444443..............68999 PP

     DUF262 185 ieleseddedqayeiFerlNsrGvpLtasellk 217
                +e++ +++e+q+ eiF r+NsrG+ L++++ + 
  VIMSS1878 194 LEISASATEEQVSEIFVRINSRGRTLNQADFIL 226
                999999************************875 PP

  == domain 2  score: -2.7 bits;  conditional E-value: 0.3
     DUF262 122 rseklsleekeelaelnsltkkdlakeekrneeknlikayevie 165
                ++ ++s+e ++e++++ ++ +k++ + +++    ++ik   +i+
  VIMSS1878 297 QTGEFSPERRDEQFDRLEKAQKEVLNLQNWHDFLKVIKRAGYIH 340
                44455555555555555555555544444444444444444444 PP



Or compare VIMSS1878 to CDD or PaperBLAST