PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS28284 to PF03235 (DUF262)

VIMSS28284 has 282 amino acids

Query:       DUF262  [M=221]
Accession:   PF03235.14
Description: Protein of unknown function DUF262
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.7e-39  122.4   2.3    1.7e-39  122.4   2.3    1.7  2  VIMSS28284  


Domain annotation for each sequence (and alignments):
>> VIMSS28284  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  122.4   2.3   1.7e-39   1.7e-39       3     220 ..      14     232 ..      12     233 .. 0.68
   2 ?   -1.1   0.2     0.095     0.095     110     139 ..     245     274 ..     231     280 .. 0.40

  Alignments for each domain:
  == domain 1  score: 122.4 bits;  conditional E-value: 1.7e-39
      DUF262   3 dllskskrg.lriPdfQRpyvWeeeqveeLiedlla......lkgyplGsivlw...skaadsageleviDGQQRltTltlllaa..t..keesekrik 87 
                 d+l     + ++iPd+QRpy W+e+++e+L++dl         +gy++Gs+vl     + + +a +++++DGQQRl+T++ll+++  t  ++ ++    
  VIMSS28284  14 DILATALVSyYQIPDYQRPYQWTEKNCEKLLDDLFSsyeyykESGYFCGSLVLIvinTDSETNAETYDIVDGQQRLSTFILLAKVlaTlyDKDLDTTSR 112
                 55555555568******************************99***********986556666**********************32122222222222 PP

      DUF262  88 nleaeiekekeeededrlkrrere.sdkellqkllrseklsleekeelaelnsltkkdlakeekrneeknlikayevieeilksa.......llsalkt 178
                 +l++++ +    e+++rl ++     +k+++ + l++ ++s                  +  +++n+++n++k+   ++++lk++       ++ +l+ 
  VIMSS28284 113 ELLEKSLGDTGGEKRERLHFNAMGlNAKDDFVYALEHFNDS------------------QASKNKNNKNNYLKNAICLKDYLKEKeikdinaFITWLYF 193
                 22222222222333333333322223333333333333333..................4445577777777777777777777777777666667777 PP

      DUF262 179 klslieieleseddedqayeiFerlNsrGvpLtasellkall 220
                 k+ +i+ ++ +    + a +iF +lN+rG+pL a + +k +l
  VIMSS28284 194 KVVFIKTTCPNV---SMALRIFSVLNARGLPLHAIDVFKVEL 232
                 777777777755...55*********************9776 PP

  == domain 2  score: -1.1 bits;  conditional E-value: 0.095
      DUF262 110 resdkellqkllrseklsleekeelaelns 139
                 + s ++ l++++++++ ++ +++e++++++
  VIMSS28284 245 FLSRWSALHQKCSENESKFPKRKENKREKN 274
                 223344444444444444444333333332 PP



Or compare VIMSS28284 to CDD or PaperBLAST