PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS7272445 to PF03235 (DUF262)

VIMSS7272445 has 584 amino acids

Query:       DUF262  [M=221]
Accession:   PF03235.14
Description: Protein of unknown function DUF262
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    6.3e-37  114.0   0.0    1.1e-36  113.2   0.0    1.4  1  VIMSS7272445  


Domain annotation for each sequence (and alignments):
>> VIMSS7272445  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  113.2   0.0   1.1e-36   1.1e-36       3     217 ..      15     226 ..      13     230 .. 0.74

  Alignments for each domain:
  == domain 1  score: 113.2 bits;  conditional E-value: 1.1e-36
        DUF262   3 dllskskrg.lriPdfQRpyvWeeeqveeLiedllalkgyplGsivlw............skaadsageleviDGQQRltTltlllaatkeesekri 86 
                    ll+++++g + +Pd+QRp+vW++ +v++L++++  ++gyp+G++++w               +++ ++l+v+DGQQRlt+l+ ++++     +k++
  VIMSS7272445  15 GLLESIDSGeIGLPDIQRPFVWDTTRVRDLFDSM--YRGYPIGTLLFWengfpgehrtigTGPKKKVPRLLVVDGQQRLTALYSVMKG-VPIVDKNF 108
                   688888888899**********************..********************9997555566**********************.33333444 PP

        DUF262  87 knleaeiek....ekeeededrlkrreresdkellqkllrseklsleekeelaelnsltkkdlakeekrneeknlikayevieeilksallsalktk 179
                    +    i      ek+e  +   ++ er+  +    ++l +e+++l + ++++ ++  +++ l++ee+ +  ++++k+ ++ +              
  VIMSS7272445 109 RQRRLRIAFnpleEKFEVTN---TSIERDPTWISDISILWQEGFALYDFISSFMKRLEERRGLTEEERQRIPRSIQKLVNLVN-------------- 188
                   43333333332212222222...334555677777778888888877766665555666666655554444444444444443.............. PP

        DUF262 180 lslieieleseddedqayeiFerlNsrGvpLtasellk 217
                   + ++ +e++ +++e+q+ eiF r+NsrG+ L++++ + 
  VIMSS7272445 189 YPMTALEISASATEEQVSEIFVRINSRGRTLNQADFIL 226
                   68999999999************************875 PP



Or compare VIMSS7272445 to CDD or PaperBLAST