PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS7777980 to PF03235 (DUF262)

VIMSS7777980 has 527 amino acids

Query:       DUF262  [M=221]
Accession:   PF03235.14
Description: Protein of unknown function DUF262
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.1e-29   90.3   0.4    3.5e-29   88.7   0.4    1.8  1  VIMSS7777980  


Domain annotation for each sequence (and alignments):
>> VIMSS7777980  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   88.7   0.4   3.5e-29   3.5e-29       5     219 ..      12     216 ..       8     218 .. 0.71

  Alignments for each domain:
  == domain 1  score: 88.7 bits;  conditional E-value: 3.5e-29
        DUF262   5 lskskrg.lriPdfQRpyvWeeeqveeLiedllalkgyplGsivlw.................skaadsageleviDGQQRltTltlllaat.kees 82 
                   l+   +g +riP+fQR++vWe ++v  L++++  +kgyp+Gs+++w                 ++ + + ++ +v+DGQQRlt+++ ++  +   e 
  VIMSS7777980  12 LDAVVSGeIRIPAFQRGFVWEMDRVAYLLDSV--YKGYPFGSLLFWrtkqqltternlgtftlPEPHADYPIDYVLDGQQRLTSIFTVFQTElVPED 106
                   555555569***********************..***************************99777888**********************444455 PP

        DUF262  83 ekriknleaeiekekeeededrlkrreresdkellqkllrseklsleekeelaelnsltkkdlakeekrneeknlikayevieeilksallsalktk 179
                   + ++++++++++   + + +d++ + ++e+ +++ +++  s  +              +++  + + ++ + +++ k+ e ++e             
  VIMSS7777980 107 NPDWADIYFDLQA--TGNPQDSVFIAIQEEGWDRNRYFPMSVLFDS-----------VKYRASTAHLNEGQIAQIDKLQEKFKE------------- 177
                   5555555555554..2233333333333333333333333333332...........233333444446666666666666666............. PP

        DUF262 180 lslieieleseddedqayeiFerlNsrGvpLtasellkal 219
                   +s+ + +l+ ++d + ++++Fer+N  Gv+L++  ll a+
  VIMSS7777980 178 ISIPVQVLK-SEDRSIVAIVFERINHLGVALDTLQLLSAW 216
                   355555555.5888*********************99886 PP



Or compare VIMSS7777980 to CDD or PaperBLAST