PaperBLAST – Find papers about a protein or its homologs

 

Align WP_076969233.1 to PF03235 (DUF262)

WP_076969233.1 has 361 amino acids

Query:       DUF262  [M=221]
Accession:   PF03235.14
Description: Protein of unknown function DUF262
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.9e-19   56.2   7.3    3.7e-13   36.2   1.3    2.9  3  WP_076969233.1  


Domain annotation for each sequence (and alignments):
>> WP_076969233.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   36.2   1.3   3.7e-13   3.7e-13       4      89 ..      13     112 ..      10     117 .. 0.75
   2 !   23.9   0.1   2.2e-09   2.2e-09     178     220 ..     114     154 ..     100     155 .. 0.83
   3 ?   -0.2   0.2     0.051     0.051     109     126 ..     276     293 ..     215     346 .. 0.55

  Alignments for each domain:
  == domain 1  score: 36.2 bits;  conditional E-value: 3.7e-13
          DUF262   4 llskskrg............lriPdfQRpyvWeeeqveeLiedllalkgyplGsivlwskaadsageleviDGQQRltTltlllaa....t...k 79 
                     l+++++++             + P +QR++ +++eq++  i+ +   +++pl  ++    a++++g++e+ D QQR+ ++  +l++    +    
  WP_076969233.1  13 LFDSYTDNeekgvlgygkklDIRPPYQREFIYKDEQRKAVIDTI--INSFPLNIMYW---AKKEDGTFELMDSQQRTVAICQYLNNifsyDslyY 102
                     555555555555666555533889********************..*******9999...7788**********************665413454 PP

          DUF262  80 eesekriknl 89 
                     ++++k+ik+ 
  WP_076969233.1 103 DNQQKDIKEK 112
                     4555555444 PP

  == domain 2  score: 23.9 bits;  conditional E-value: 2.2e-09
          DUF262 178 tklslieieleseddedqayeiFerlNsrGvpLtasellkall 220
                      +++l+++++e   ++++  + F+++N+ G++Lt++el++a +
  WP_076969233.1 114 LNYKLMVYICE--GTDSEKLKWFKTINTAGEKLTDQELRNAIY 154
                     57899*****9..67779**********************987 PP

  == domain 3  score: -0.2 bits;  conditional E-value: 0.051
          DUF262 109 eresdkellqkllrsekl 126
                        s+k  +q++l  ++ 
  WP_076969233.1 276 DVTSNKGIYQYILTRKEK 293
                     111222222222222222 PP



Or compare WP_076969233.1 to CDD or PaperBLAST