Q895R2 has 152 amino acids
Query: PCC [M=117]
Accession: PF03479.19
Description: Plants and Prokaryotes Conserved (PCC) domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-36 110.9 0.0 3e-36 110.6 0.0 1.1 1 Q895R2
Domain annotation for each sequence (and alignments):
>> Q895R2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 110.6 0.0 3e-36 3e-36 3 113 .. 23 131 .. 21 134 .. 0.96
Alignments for each domain:
== domain 1 score: 110.6 bits; conditional E-value: 3e-36
PCC 3 fvlrlepGedilesleefareegiraacvlsaiGavsnatlglvdgeekeyeekellgpfEilslsGtisptdgepflHlhvsladedgqvvgGhlveglvaa 105
+++rl++G++i+es++ ++++e+i++a v s+iGa +++ +g+++ e+k+y+ek+++g+fEi+sl+G++s+ ++++++Hlh+ l+d+d +v gGhl ++++ +
Q895R2 23 YLIRLDRGDEIIESIKVLCKKEDIKGAKV-SGIGATNQVVIGIYELENKKYNEKQFKGDFEITSLVGNVSTYKDNLIPHLHINLGDKDFNVKGGHLQSAII-S 123
89***************************.*****************************************8888**********************7777.* PP
PCC 106 ttvevvia 113
t e+++
Q895R2 124 VTGEIFLE 131
*****986 PP
Or compare Q895R2 to CDD or PaperBLAST