VIMSS1100470 has 140 amino acids
Query: PCC [M=117] Accession: PF03479.19 Description: Plants and Prokaryotes Conserved (PCC) domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-29 88.7 0.1 2.2e-29 88.4 0.1 1.1 1 VIMSS1100470 Domain annotation for each sequence (and alignments): >> VIMSS1100470 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.4 0.1 2.2e-29 2.2e-29 2 113 .. 9 118 .. 8 121 .. 0.96 Alignments for each domain: == domain 1 score: 88.4 bits; conditional E-value: 2.2e-29 PCC 2 vfvlrlepGedilesleefareegiraacvlsaiGavsnatlglvdgeekeyeekellgpfEilslsGtisptdgepflHlhvsladedgqvvgGhl 98 ++++rle G++++++l+ +a++ + + + s+iGa++++t+++++ ++++y e++ ++++E+lslsG++ + dg+++ Hlh+s+a+ d +v+gGhl VIMSS1100470 9 QIICRLEVGDELITELKYLAATLPDQLGAI-SGIGACNDVTVSIYSPDSDSYVETRSQEQVELLSLSGNVENADGKISTHLHASFARLDTSVFGGHL 104 6899*******************9999999.****************************************************************** PP PCC 99 veglvaattvevvia 113 ++++ + t e+vi VIMSS1100470 105 ERAVI-SRTGELVIS 118 *8888.*******97 PP
Or compare VIMSS1100470 to CDD or PaperBLAST