PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1100470 to PF03479 (PCC)

VIMSS1100470 has 140 amino acids

Query:       PCC  [M=117]
Accession:   PF03479.19
Description: Plants and Prokaryotes Conserved (PCC) domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.8e-29   88.7   0.1    2.2e-29   88.4   0.1    1.1  1  VIMSS1100470  


Domain annotation for each sequence (and alignments):
>> VIMSS1100470  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   88.4   0.1   2.2e-29   2.2e-29       2     113 ..       9     118 ..       8     121 .. 0.96

  Alignments for each domain:
  == domain 1  score: 88.4 bits;  conditional E-value: 2.2e-29
           PCC   2 vfvlrlepGedilesleefareegiraacvlsaiGavsnatlglvdgeekeyeekellgpfEilslsGtisptdgepflHlhvsladedgqvvgGhl 98 
                   ++++rle G++++++l+ +a++   + + + s+iGa++++t+++++ ++++y e++ ++++E+lslsG++ + dg+++ Hlh+s+a+ d +v+gGhl
  VIMSS1100470   9 QIICRLEVGDELITELKYLAATLPDQLGAI-SGIGACNDVTVSIYSPDSDSYVETRSQEQVELLSLSGNVENADGKISTHLHASFARLDTSVFGGHL 104
                   6899*******************9999999.****************************************************************** PP

           PCC  99 veglvaattvevvia 113
                    ++++ + t e+vi 
  VIMSS1100470 105 ERAVI-SRTGELVIS 118
                   *8888.*******97 PP



Or compare VIMSS1100470 to CDD or PaperBLAST