VIMSS188324 has 134 amino acids
Query: PCC [M=117] Accession: PF03479.19 Description: Plants and Prokaryotes Conserved (PCC) domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-39 120.9 0.1 2.1e-39 120.7 0.1 1.0 1 VIMSS188324 Domain annotation for each sequence (and alignments): >> VIMSS188324 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 120.7 0.1 2.1e-39 2.1e-39 1 117 [] 6 119 .. 6 119 .. 0.98 Alignments for each domain: == domain 1 score: 120.7 bits; conditional E-value: 2.1e-39 PCC 1 rvfvlrlepGedilesleefareegiraacvlsaiGavsnatlglvdgeekeyeekellgpfEilslsGtisptdgepflHlhvsladedgqvvgGhl 98 rv+++r+++G++i+e l+efa++e+i+ +++ saiG+++n +g++ +eek+y+e++l+g++E+lslsG+is++dg+pf+H hv+l+d++g+++gGhl VIMSS188324 6 RVYLFRIPEGKEIIEFLREFAEKENIKVGII-SAIGTLRNPVIGYFMEEEKKYKEISLTGTYELLSLSGNISLKDGKPFVHAHVVLGDSEGRAFGGHL 102 799****************************.****************************************************************** PP PCC 99 veglvaattvevviaefeg 117 v+g v +++ev+++e+eg VIMSS188324 103 VRGEV--FVAEVFVQELEG 119 ***99..9********985 PP
Or compare VIMSS188324 to CDD or PaperBLAST