PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5418163 to PF03653 (UPF0093)

VIMSS5418163 has 204 amino acids

Query:       UPF0093  [M=146]
Accession:   PF03653.16
Description: Uncharacterised protein family (UPF0093)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.8e-54  169.6   7.5    4.2e-54  169.0   6.0    1.7  2  VIMSS5418163  


Domain annotation for each sequence (and alignments):
>> VIMSS5418163  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  169.0   6.0   4.2e-54   4.2e-54       3     145 ..      11     156 ..       9     157 .. 0.96
   2 ?   -0.4   0.0     0.069     0.069      14      23 ..     168     177 ..     161     199 .. 0.55

  Alignments for each domain:
  == domain 1  score: 169.0 bits;  conditional E-value: 4.2e-54
       UPF0093   3 alylwvkalHiiavisWmAglfylPRlfvyhaeakeks.eekellk....imerrLlkiimnpamivtlvlGllllvlaeglvvlssgWlhvKlllv 94 
                   ++y w+ka+Hii v++W+Aglfyl Rlfvyhaea++++  ++++lk    +me+rL++ii++p m+vt++++++++ +++g+  l++ Wlh+Kl+lv
  VIMSS5418163  11 QAYFWFKAFHIIGVVVWFAGLFYLVRLFVYHAEAEKEPePARSILKkqyeLMEKRLYNIITQPGMFVTVAMAIAVISTEPGV--LKAWWLHAKLALV 105
                   68*********************************999788888889999**********************9999999987..7789********* PP

       UPF0093  95 llllifhlvlakllkklergentksekfyrilNEvptlllivivllvvvkp 145
                   +lll++h++++++++kl++g++t++++++r+lNE+ptlll+ iv+l+v+k+
  VIMSS5418163 106 VLLLVYHFFCGRIMRKLAEGTCTWTGQQFRALNEAPTLLLVTIVMLAVFKN 156
                   *************************************************96 PP

  == domain 2  score: -0.4 bits;  conditional E-value: 0.069
       UPF0093  14 iavisWmAgl 23 
                   +a+i++mA+ 
  VIMSS5418163 168 LALIVFMAAA 177
                   3444444432 PP



Or compare VIMSS5418163 to CDD or PaperBLAST