D6RAA6 has 222 amino acids
Query: TMEM33_Pom33 [M=240] Accession: PF03661.17 Description: Transmembrane protein 33/Nucleoporin POM33 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-95 303.7 10.7 5.3e-95 303.4 10.7 1.0 1 D6RAA6 Domain annotation for each sequence (and alignments): >> D6RAA6 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 303.4 10.7 5.3e-95 5.3e-95 7 217 .. 12 222 .] 7 222 .] 0.98 Alignments for each domain: == domain 1 score: 303.4 bits; conditional E-value: 5.3e-95 TMEM33_Pom33 7 eslkqhvvanklelalwlarlltvlftvlyilplflssesasaYykallanaatsalrLhqrlpqvqlsreflqrllledschyLlysliFlfsapv 103 + ++q++++nkl++a+wl+rl+tv++++l++lpl++ +e+as+Y++allana+tsalrLhqrlp++qlsr+fl+++lledschyLlysliF++s+pv D6RAA6 12 AGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPV 108 5689********************************************************************************************* PP TMEM33_Pom33 104 tlallPvalfallHaasytltlldllgsnslvvarllislvesqsqniLkliAlsEivlmpllivllllgraslltpliYyqfLslRYsSrrnPytr 200 t++++Pv+lf+llHaa+yt+++ld gsnsl++ r ++++++++qniLk+iA++Ei+lmp+++++l++g++sll+p+iYy+fL+lRYsSrrnPy+r D6RAA6 109 TMSIFPVLLFSLLHAATYTKKVLDARGSNSLPLLRSVLDKLSANQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCR 205 ************************************************************************************************* PP TMEM33_Pom33 201 nafselrilleklankp 217 ++f+elri++e++++kp D6RAA6 206 TLFNELRIVVEHIIMKP 222 *************9997 PP
Or compare D6RAA6 to CDD or PaperBLAST