PaperBLAST – Find papers about a protein or its homologs

 

Align O70378 to PF03665 (UPF0172)

O70378 has 207 amino acids

Query:       UPF0172  [M=193]
Accession:   PF03665.16
Description: Uncharacterised protein family (UPF0172)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    5.3e-70  221.5   0.0      6e-70  221.3   0.0    1.0  1  O70378    


Domain annotation for each sequence (and alignments):
>> O70378  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  221.3   0.0     6e-70     6e-70       2     192 ..       4     198 ..       3     199 .. 0.96

  Alignments for each domain:
  == domain 1  score: 221.3 bits;  conditional E-value: 6e-70
  UPF0172   2 vevseqAYvKlllHaaKyptqaVnGvLlGkkssdkskk......avevtDavPLfHssttlspmlevAlaqvesyakekglvivGyYqanerlsdtelssla 97 
              v++++qAY+K++lH aKyp++aVnG+L++++++ ++++      ++ ++D++PLfH +++l+pmlevAl++++s++k++++vi+GyYqaner++d +++++a
   O70378   4 VKLTTQAYCKMVLHGAKYPHCAVNGLLVAERQRPRKEHppgagsHTLFVDCIPLFHGTLALTPMLEVALTLIDSWCKDNSYVIAGYYQANERVKDASPNQVA 105
              6899*****************************99888******9********************************************************* PP

  UPF0172  98 ekiadkiaenfsdavllvvdnkkleseseeeallalykkdslgkwkkkkesseasekkasakealsnlldkkkyeqlvDFddHLddisldwlnqe 192
              ek+a++iae f da+l++vdn k++++++  + +++y++++ ++w+  + +    e+  +a+++ ++lld+++ye+lvDFd+HLddi+ dw+n+e
   O70378 106 EKVASRIAEGFGDAALIMVDNAKFTMDCAA-PTIHVYEQHE-NRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRSDWTNPE 198
              *************************99999.566*******.****8777777777778**********************************97 PP



Or compare O70378 to CDD or PaperBLAST