VIMSS10109626 has 68 amino acids
Query: UPF0172 [M=193]
Accession: PF03665.16
Description: Uncharacterised protein family (UPF0172)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.7e-12 31.9 0.0 6.7e-12 31.9 0.0 1.1 1 VIMSS10109626
Domain annotation for each sequence (and alignments):
>> VIMSS10109626
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 31.9 0.0 6.7e-12 6.7e-12 66 103 .. 1 38 [. 1 66 [. 0.87
Alignments for each domain:
== domain 1 score: 31.9 bits; conditional E-value: 6.7e-12
UPF0172 66 qvesyakekglvivGyYqanerlsdtelsslaekiadk 103
++e+++ ++gl+ivGy++aner++d el+ +a++i +k
VIMSS10109626 1 MIEEHYVAQGLSIVGYFHANERFDDVELCGVAKNIGSK 38
6999*******************************876 PP
Or compare VIMSS10109626 to CDD or PaperBLAST