VIMSS15929 has 59 amino acids
Query: UPF0181 [M=50]
Accession: PF03701.18
Description: Uncharacterised protein family (UPF0181)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-33 100.9 3.6 1.3e-33 100.7 3.6 1.1 1 VIMSS15929
Domain annotation for each sequence (and alignments):
>> VIMSS15929
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 100.7 3.6 1.3e-33 1.3e-33 1 49 [. 1 49 [. 1 50 [. 0.98
Alignments for each domain:
== domain 1 score: 100.7 bits; conditional E-value: 1.3e-33
UPF0181 1 MldglpaLtHeqQQqAVErIqeLmaqGissgeAIalVAqelReehqkke 49
M++glp+LtHeqQQ+AVErIqeLmaqG+ssg+AIalVA+elR++h++++
VIMSS15929 1 MFAGLPSLTHEQQQKAVERIQELMAQGMSSGQAIALVAEELRANHSGER 49
9********************************************9985 PP
Or compare VIMSS15929 to CDD or PaperBLAST