WP_014690981.1 has 173 amino acids
Query: DUF308 [M=73] Accession: PF03729.17 Description: Short repeat of unknown function (DUF308) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-16 45.2 48.2 8.4e-14 38.0 17.2 3.2 3 WP_014690981.1 Domain annotation for each sequence (and alignments): >> WP_014690981.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.0 17.2 8.4e-14 8.4e-14 1 72 [. 11 82 .. 11 83 .. 0.97 2 ! 12.9 8.0 5.7e-06 5.7e-06 1 46 [. 69 114 .. 69 123 .. 0.87 3 ! 12.4 14.1 8e-06 8e-06 2 46 .. 123 167 .. 122 173 .] 0.90 Alignments for each domain: == domain 1 score: 38.0 bits; conditional E-value: 8.4e-14 DUF308 1 llGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaarkkegggfwllllsGilyiiaGllll 72 l G+++++lGi+a++wP a+l ++ +l+G+ ll+ G+v++v+ + + g++l +++G+l ++G+l+l WP_014690981.1 11 LAGVFALVLGIVAFAWPSATLHVVGFLFGLNLLILGVVRVVQFVLIPDAPVAGRVLGVIFGVLVGLLGILCL 82 57********************************************************************98 PP == domain 2 score: 12.9 bits; conditional E-value: 5.7e-06 DUF308 1 llGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaa 46 + G+l +lGil+l +l +l +++++ ++++G++++++++ + WP_014690981.1 69 IFGVLVGLLGILCLRDLAGSLKLLLVIVALGWMLDGLAEIFTSVGS 114 579*************************************998833 PP == domain 3 score: 12.4 bits; conditional E-value: 8e-06 DUF308 2 lGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaa 46 +G++ +++++++l+wPg+ l+++v++ + l++ Gi++++ ++a WP_014690981.1 123 VGLCVVLAAVALLVWPGLGLATFVFFGATTLCFVGIAGILIGIAG 167 8**************************************988754 PP
Or compare WP_014690981.1 to CDD or PaperBLAST