VIMSS15911 has 84 amino acids
Query: DUF333 [M=48]
Accession: PF03891.19
Description: Domain of unknown function (DUF333)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.6e-25 74.8 0.1 3.2e-25 74.5 0.1 1.1 1 VIMSS15911
Domain annotation for each sequence (and alignments):
>> VIMSS15911
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 74.5 0.1 3.2e-25 3.2e-25 1 48 [] 32 78 .. 32 78 .. 0.98
Alignments for each domain:
== domain 1 score: 74.5 bits; conditional E-value: 3.2e-25
DUF333 1 gmaNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrgd 48
gmaNPAsvyC+q+GG+l +v++a+ g C+Lp Ge+++eWal+r+d
VIMSS15911 32 GMANPASVYCQQKGGTLIPVQTAQ-GVSNNCKLPGGETIDEWALWRRD 78
7***********************.*********************96 PP
Or compare VIMSS15911 to CDD or PaperBLAST