PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1936488 to PF03891 (DUF333)

VIMSS1936488 has 88 amino acids

Query:       DUF333  [M=48]
Accession:   PF03891.19
Description: Domain of unknown function (DUF333)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.6e-18   53.1   0.3    2.1e-18   52.7   0.3    1.2  1  VIMSS1936488  


Domain annotation for each sequence (and alignments):
>> VIMSS1936488  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   52.7   0.3   2.1e-18   2.1e-18       2      47 ..      38      83 ..      37      84 .. 0.95

  Alignments for each domain:
  == domain 1  score: 52.7 bits;  conditional E-value: 2.1e-18
        DUF333  2 maNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrg 47
                  m ++ +++C+++GG l+++++ dG  ig+C+Lp+G+r++e++l  g
  VIMSS1936488 38 MSSSGEANCAMIGGSLSVARQLDGTAIGMCALPNGKRCSEQSLAAG 83
                  88999*************************************9876 PP



Or compare VIMSS1936488 to CDD or PaperBLAST