VIMSS1936488 has 88 amino acids
Query: DUF333 [M=48] Accession: PF03891.19 Description: Domain of unknown function (DUF333) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-18 53.1 0.3 2.1e-18 52.7 0.3 1.2 1 VIMSS1936488 Domain annotation for each sequence (and alignments): >> VIMSS1936488 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 52.7 0.3 2.1e-18 2.1e-18 2 47 .. 38 83 .. 37 84 .. 0.95 Alignments for each domain: == domain 1 score: 52.7 bits; conditional E-value: 2.1e-18 DUF333 2 maNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrg 47 m ++ +++C+++GG l+++++ dG ig+C+Lp+G+r++e++l g VIMSS1936488 38 MSSSGEANCAMIGGSLSVARQLDGTAIGMCALPNGKRCSEQSLAAG 83 88999*************************************9876 PP
Or compare VIMSS1936488 to CDD or PaperBLAST