VIMSS55940 has 93 amino acids
Query: DUF333 [M=48] Accession: PF03891.19 Description: Domain of unknown function (DUF333) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-26 78.6 0.2 3.6e-26 77.6 0.3 1.5 2 VIMSS55940 Domain annotation for each sequence (and alignments): >> VIMSS55940 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.0 0.39 0.39 34 44 .. 6 16 .. 4 17 .. 0.68 2 ! 77.6 0.3 3.6e-26 3.6e-26 1 48 [] 43 89 .. 43 89 .. 0.98 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.39 DUF333 34 pdGerveeWal 44 ++Ge ++ al VIMSS55940 6 KNGESMNKTAL 16 68888776665 PP == domain 2 score: 77.6 bits; conditional E-value: 3.6e-26 DUF333 1 gmaNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrgd 48 +maNPAsvyCv+qGG+le+v++++ ++++yCv +dGe++e+W+++r++ VIMSS55940 43 SMANPASVYCVEQGGQLEMVTENE-QRVTYCVTKDGEKIEQWEYFRQN 89 5***********************.*********************86 PP
Or compare VIMSS55940 to CDD or PaperBLAST