VIMSS74021 has 84 amino acids
Query: DUF333 [M=48]
Accession: PF03891.19
Description: Domain of unknown function (DUF333)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-24 72.7 0.1 1.5e-24 72.4 0.1 1.1 1 VIMSS74021
Domain annotation for each sequence (and alignments):
>> VIMSS74021
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 72.4 0.1 1.5e-24 1.5e-24 1 46 [. 32 76 .. 32 78 .. 0.98
Alignments for each domain:
== domain 1 score: 72.4 bits; conditional E-value: 1.5e-24
DUF333 1 gmaNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyr 46
gmaNPAsvyC+q+GG+l +v++a+ g C+Lp Ge+++eWal+r
VIMSS74021 32 GMANPASVYCQQKGGTLIPVQTAQ-GVSNNCKLPGGETIDEWALWR 76
7***********************.********************9 PP
Or compare VIMSS74021 to CDD or PaperBLAST