VIMSS818571 has 71 amino acids
Query: DUF333 [M=48]
Accession: PF03891.19
Description: Domain of unknown function (DUF333)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.5e-24 71.2 0.3 5.2e-24 70.7 0.3 1.3 1 VIMSS818571
Domain annotation for each sequence (and alignments):
>> VIMSS818571
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 70.7 0.3 5.2e-24 5.2e-24 1 47 [. 23 69 .. 23 70 .. 0.98
Alignments for each domain:
== domain 1 score: 70.7 bits; conditional E-value: 5.2e-24
DUF333 1 gmaNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrg 47
gmaN+As++C+++GG+ e++kd++Gg + +C+Lpd + veeW+++r+
VIMSS818571 23 GMANSASKFCIAKGGRREVKKDESGGGYALCHLPDSRIVEEWEYCRS 69
7*********************************************7 PP
Or compare VIMSS818571 to CDD or PaperBLAST