VIMSS899559 has 83 amino acids
Query: DUF333 [M=48] Accession: PF03891.19 Description: Domain of unknown function (DUF333) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-25 74.2 0.0 4.9e-25 74.0 0.0 1.1 1 VIMSS899559 Domain annotation for each sequence (and alignments): >> VIMSS899559 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 74.0 0.0 4.9e-25 4.9e-25 1 48 [] 31 77 .. 31 77 .. 0.98 Alignments for each domain: == domain 1 score: 74.0 bits; conditional E-value: 4.9e-25 DUF333 1 gmaNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrgd 48 gm+NPA+vyC+qqGG+l +v++++ g C+Lp+Ge ++eW+l+r++ VIMSS899559 31 GMPNPAAVYCEQQGGTLMPVQTPQ-GVRSDCKLPNGEIIDEWTLWRRE 77 7***********************.*********************85 PP
Or compare VIMSS899559 to CDD or PaperBLAST