WP_002224603.1 has 48 amino acids
Query: DUF333 [M=48]
Accession: PF03891.19
Description: Domain of unknown function (DUF333)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-24 72.8 0.0 1.2e-24 72.7 0.0 1.0 1 WP_002224603.1
Domain annotation for each sequence (and alignments):
>> WP_002224603.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 72.7 0.0 1.2e-24 1.2e-24 2 48 .] 1 47 [. 1 47 [. 0.98
Alignments for each domain:
== domain 1 score: 72.7 bits; conditional E-value: 1.2e-24
DUF333 2 maNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrgd 48
maN+As++C+++GG+ e++kd++Gg + +C+Lpd + veeW+++r++
WP_002224603.1 1 MANSASKFCIAKGGRREVKKDESGGGYALCHLPDSRIVEEWEYFRSQ 47
9********************************************85 PP
Or compare WP_002224603.1 to CDD or PaperBLAST