WP_005535975.1 has 86 amino acids
Query: DUF333 [M=48]
Accession: PF03891.19
Description: Domain of unknown function (DUF333)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.9e-22 65.6 0.9 2.6e-22 65.2 0.9 1.2 1 WP_005535975.1
Domain annotation for each sequence (and alignments):
>> WP_005535975.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 65.2 0.9 2.6e-22 2.6e-22 3 48 .] 35 79 .. 33 79 .. 0.96
Alignments for each domain:
== domain 1 score: 65.2 bits; conditional E-value: 2.6e-22
DUF333 3 aNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrgd 48
aNPA+vyCvqqGG+l++v+++ +++yC+L+ er e+W++yr++
WP_005535975.1 35 ANPAAVYCVQQGGELDTVTENG-ERVTYCQLSENERFEQWEYYRNN 79
9*******************99.*********************86 PP
Or compare WP_005535975.1 to CDD or PaperBLAST