Q7WY72 has 89 amino acids
Query: RemA-like [M=73]
Accession: PF04025.16
Description: Extracellular matrix regulatory protein A-like
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.4e-41 126.8 0.5 1.7e-41 126.6 0.5 1.1 1 Q7WY72
Domain annotation for each sequence (and alignments):
>> Q7WY72
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 126.6 0.5 1.7e-41 1.7e-41 1 73 [] 5 77 .. 5 77 .. 0.99
Alignments for each domain:
== domain 1 score: 126.6 bits; conditional E-value: 1.7e-41
RemA-like 1 liniGfgnvVnadriiaivspdsapikrliqeakeegklidaTqgrktrsviitdsghviLSalqpetlakRl 73
liniGfgn+++a+r+i+ivsp+sapikr+iq+a+++g+lidaT+gr+tr+v+++ds+h+iLSa+qpet+a+Rl
Q7WY72 5 LINIGFGNIISANRMISIVSPESAPIKRMIQDARDRGMLIDATYGRRTRAVVVMDSDHIILSAVQPETVAHRL 77
8**********************************************************************97 PP
Or compare Q7WY72 to CDD or PaperBLAST