Q7WY72 has 89 amino acids
Query: RemA-like [M=73] Accession: PF04025.16 Description: Extracellular matrix regulatory protein A-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-41 126.8 0.5 1.7e-41 126.6 0.5 1.1 1 Q7WY72 Domain annotation for each sequence (and alignments): >> Q7WY72 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 126.6 0.5 1.7e-41 1.7e-41 1 73 [] 5 77 .. 5 77 .. 0.99 Alignments for each domain: == domain 1 score: 126.6 bits; conditional E-value: 1.7e-41 RemA-like 1 liniGfgnvVnadriiaivspdsapikrliqeakeegklidaTqgrktrsviitdsghviLSalqpetlakRl 73 liniGfgn+++a+r+i+ivsp+sapikr+iq+a+++g+lidaT+gr+tr+v+++ds+h+iLSa+qpet+a+Rl Q7WY72 5 LINIGFGNIISANRMISIVSPESAPIKRMIQDARDRGMLIDATYGRRTRAVVVMDSDHIILSAVQPETVAHRL 77 8**********************************************************************97 PP
Or compare Q7WY72 to CDD or PaperBLAST